mRNA-CD79B

Cat.#	Gene	Scale	State
LS-RMAbt-065	mRNA—CD79B	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-065 mRNA—CD79B 1mg Lyophilized/Liquid
Product Overview

mRNA-CD79B is an in vitro transcribed (IVT) messenger RNA encoding the CD79B protein (also known as Igβ or B29), a critical component of the B-cell receptor (BCR) complex. CD79B pairs with CD79A (Igα) to form the signaling module of the BCR, playing an essential role in B-cell development, antigen recognition, and immune response activation. This mRNA-based approach enables controlled and transient expression of CD79B, making it valuable for research in B-cell biology, immunotherapy development, and studies of B-cell-related diseases such as lymphomas and autoimmune disorders.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 987 nt

Amino acid sequence size: 229 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months