mRNA-CD79A

Cat.#	Gene	Scale	State
LS-RMAbt-064	mRNA-CD79A	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-064 mRNA-CD79A 1mg Lyophilized/Liquid
Product Overview

mRNA-CD79A is an in vitro transcribed (IVT) messenger RNA encoding the CD79A protein (also known as Igα or MB-1), a fundamental component of the B-cell receptor (BCR) complex that partners with CD79B to mediate B-cell signaling, development and antigen response. This synthetic mRNA platform enables transient, dose-controlled expression of functional CD79A for applications in B-cell biology research, BCR signaling studies, and potential therapeutic development for B-cell malignancies and immune disorders.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 978 nt

Amino acid sequence size: 226 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months