mRNA-CD70

Cat.#	Gene	Scale	State
LS-RMAbt-161	mRNA-CD70	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-161 mRNA-CD70 1mg Lyophilized/Liquid
Product Overview

An in vitro transcribed (IVT) messenger RNA encoding CD70 (CD27 ligand), a transmembrane protein transiently expressed on activated T and B cells and constitutively on some renal cell carcinomas. This synthetic mRNA enables controlled expression of CD70 for research in T-cell co-stimulation, developing CD70-targeted CAR-T therapies, and investigating chronic lymphocytic leukemia (CLL) biology.

Concentration: 1mg/mL

Storage Buffer: ddH₂O ph=7.0

mRNA length: 879 nt

Amino acid sequence size: 193 da

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months