mRNA-CD7

Cat.#	Gene	Scale	State
LS-RMAbt-007	mRNA-CD7	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-007 mRNA-CD7 1mg Lyophilized/Liquid
Product Overview

mRNA-CD7 is a ready-to-use mRNA product encoding the CD7 molecule. It is suitable for T cell activation studies, immune signaling regulation research, mRNA delivery investigations, and immunotherapy research. CD7 is a transmembrane glycoprotein expressed on the surface of T cells and natural killer (NK) cells, belonging to the immunoglobulin superfamily. It plays an important role in T cell activation, immune synapse formation, cell proliferation, and apoptosis.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1023 nt

Amino acid sequence size: 241 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ*
Cell Expression result:

Cell Line: A549

Culture Plate: 96-well plate

Cell Confluency: 80%

Transfection Dose: 200 ng per well
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months