mRNA-CD63

Cat.#	Gene	Scale	State
LS-RMAbt-070	mRNA-CD63	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-070 mRNA-CD63 1mg Lyophilized/Liquid
Product Overview

mRNA-CD63 is an in vitro transcribed (IVT) messenger RNA encoding the CD63 protein, a tetraspanin family member widely used as an exosome marker that plays roles in intracellular trafficking, membrane fusion, and immune cell modulation. This synthetic mRNA enables controlled expression of CD63 for research in extracellular vesicle biology, cancer metastasis studies, and investigations of viral entry mechanisms.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1014 nt

Amino acid sequence size: 238 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months