mRNA-CD58

Cat.#	Gene	Scale	State
LS-RMAbt-014	mRNA-CD58	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-014 mRNA-CD58 1mg Lyophilized/Liquid
Product Overview

mRNA-CD58 is a ready-to-use mRNA product encoding the CD58 molecule (also known as LFA-3, Lymphocyte Function-Associated Antigen 3). It is suitable for T cell immunology research, NK cell activation studies, mRNA delivery research, and tumor immunology investigations. CD58 is a member of the immunoglobulin superfamily (IgSF) and is broadly expressed on antigen-presenting cells (APCs), T cells, B cells, and endothelial cells. It plays a crucial role in T cell–APC interactions, immune synapse formation, and cytotoxic immune responses. As a ligand for the CD2 receptor, CD58 enhances T cell and NK cell activation and cytotoxicity and holds significant research value in the context of autoimmune diseases, inflammation, and the tumor microenvironment.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1050 nt

Amino acid sequence size: 250 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months