mRNA-CD52

Cat.#	Gene	Scale	State
LS-RMAbt-144	mRNA-CD52	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-144 mRNA-CD52 1mg Lyophilized/Liquid
Product Overview

An in vitro transcribed (IVT) messenger RNA encoding CD52, a glycosylphosphatidylinositol (GPI)-anchored glycoprotein expressed on the surface of mature lymphocytes and monocytes. This synthetic mRNA enables controlled expression of CD52 for research in lymphocyte depletion strategies, modeling autoimmune diseases like multiple sclerosis, and testing the efficacy of anti-CD52 monoclonal antibodies (e.g., Alemtuzumab).

Concentration: 1mg/mL

Storage Buffer: ddH₂O ph=7.0

mRNA length: 483 nt

Amino acid sequence size: 61 da

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months