mRNA-CD5

Cat.#	Gene	Scale	State
LS-RMAbt-006	mRNA-CD5	1mg	Lyophilized/Liquid

Order Now

Contact

Description
Product Overview
Sequence
Data Chart
Storage & Logistic
Documents

Cat.# Gene Scale State

LS-RMAbt-006 mRNA-CD5 1mg Lyophilized/Liquid
Product Overview

mRNA-CD5 is a ready-to-use mRNA product encoding the CD5 molecule. It is suitable for T cell activation studies, immune signaling regulation research, mRNA delivery investigations, as well as autoimmune and tumor immunology research. CD5 is a transmembrane glycoprotein expressed on the surface of T cells and a subset of B cells, playing an important role in T cell development, immune tolerance, negative regulation of signal transduction, and modulation of the tumor microenvironment.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1788 nt

Amino acid sequence size: 496 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL*
Cell Expression Result

Cell Line: A549

Culture Plate: 96-well plate

Cell Confluency: 80%

Transfection Dose: 200 ng per well
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months