mRNA-CD37

Cat.#	Gene	Scale	State
LS-RMAbt-142	mRNA-CD37	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-142 mRNA-CD37 1mg Lyophilized/Liquid
Product Overview

An in vitro transcribed (IVT) messenger RNA encoding CD37, a tetraspanin family member constitutively expressed on mature B-cells and some T cells. This synthetic mRNA enables controlled expression of CD37 for research in hematological malignancies, investigating B-cell receptor (BCR) signaling pathways, and evaluating CD37 as a therapeutic target for antibody-drug conjugates (ADCs) or CAR-T cell therapies.

Concentration: 1mg/mL

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1143 nt

Amino acid sequence size: 281 da

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKVLAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQK WLHNNLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months