mRNA-CD247

Cat.#	Gene	Scale	State
LS-RMAbt-005	mRNA-CD247	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-005 mRNA-CD247 1mg Lyophilized/Liquid
Product Overview

mRNA-CD247 (also known as CD3Z or CD3 zeta chain) is a ready-to-use mRNA product encoding the CD3 zeta chain of the T cell receptor complex (TCR-CD3 complex). It is suitable for T cell activation research, immune signaling studies, mRNA delivery research, and cell therapy development. CD3Z plays a central role in T cell receptor (TCR) signal transduction by activating downstream signaling pathways through its ITAM (Immunoreceptor Tyrosine-based Activation Motif) domains, and is essential for T cell proliferation, cytotoxicity, and immune responses.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 792 nt

Amino acid sequence size: 164 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months