mRNA-CD152

Cat.#	Gene	Scale	State
LS-RMAbt-016	mRNA-CD152	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-016 mRNA-CD152 1mg Lyophilized/Liquid
Product Overview

mRNA-CD152 (CTLA-4, Cytotoxic T-Lymphocyte Associated Protein 4) is a ready-to-use mRNA product encoding the CTLA-4 molecule. It is suitable for T cell immune suppression studies, immune checkpoint research, mRNA delivery research, and tumor immunology investigations. CTLA-4 is a critical immune checkpoint molecule expressed on the surface of T cells. By binding to CD80/CD86, it negatively regulates T cell activation and plays a key role in immune tolerance, tumor immune evasion, and autoimmune diseases. CTLA-4 is a major target in immunotherapy, and anti-CTLA-4 monoclonal antibodies (such as Ipilimumab) have been used in cancer immunotherapy.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 969 nt

Amino acid sequence size: 223 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Cell Expression Result

Cell Line: A549
Culture Plate: 96-well plate
Cell Confluency: 80%
Transfection Dose: 200 ng per wel
Storage & Logistic
Storage Conditions: 2°C to 8°C, protect from light
Shipping Conditions: Ambient
Expiration Date of Liquid Product: 12 Months
Retest Date of Powder Product: 18 Months