mRNA-CD14

Cat.#	Gene	Scale	State
LS-RMAbt-160	mRNA-CD14	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-160 mRNA-CD14 1mg Lyophilized/Liquid
Product Overview

An in vitro transcribed (IVT) messenger RNA encoding Cluster of Differentiation 14 (CD14), a co-receptor for Toll-like receptor 4 (TLR4) that recognizes lipopolysaccharide (LPS). This synthetic mRNA enables controlled expression of CD14 for research in innate immunity, endotoxin shock models, and studying monocyte-to-macrophage differentiation.

Concentration: 1mg/mL

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1425 nt

Amino acid sequence size: 375 da

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months