mRNA-CCR5

Cat.#	Gene	Scale	State
LS-RMAbt-146	mRNA-CCR5	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-146 mRNA-CCR5 1mg Lyophilized/Liquid
Product Overview

An in vitro transcribed (IVT) messenger RNA encoding C-C chemokine receptor type 5 (CCR5), a co-receptor essential for the entry of R5-tropic HIV strains into host cells. This synthetic mRNA enables controlled expression of CCR5 for research in HIV pathogenesis, gene editing validation (e.g., CRISPR/Cas9 knockout), and allogeneic CAR-T cell engineering to confer viral resistance.

Concentration: 1mg/mL

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1356 nt

Amino acid sequence size: 352 da

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months