mRNA-BMP4

Cat.#	Gene	Scale	State
LS-RMFac-018	mRNA-BMP4	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-018 mRNA-BMP4 1mg Lyophilized/Liquid
Product Overview

mRNA-BMP4 is an in vitro transcribed (IVT) messenger RNA encoding bone morphogenetic protein 4 (BMP4), a secreted ligand of the TGF-β superfamily that regulates mesoderm patterning, bone formation, and stem cell differentiation through SMAD-dependent signaling. This synthetic mRNA enables controlled expression of BMP4 for research in embryonic development, osteogenic differentiation protocols, and regenerative medicine applications (e.g., cartilage/bone repair).

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1524 nt

Amino acid sequence size: 408 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEAISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGD CPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQ EMVVEGCGCR
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months