mRNA-ANGPTL3

Cat.#	Gene	Scale	State
LS-RMAbt-111	mRNA-ANGPTL3	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-111 mRNA-ANGPTL3 1mg Lyophilized/Liquid
Product Overview

mRNA-ANGPTL3 is an in vitro transcribed (IVT) messenger RNA encoding angiopoietin-like protein 3 (ANGPTL3), a hepatocyte-secreted glycoprotein that regulates lipid metabolism by inhibiting lipoprotein lipase (LPL) and endothelial lipase (EL) activity. This synthetic mRNA enables controlled expression of ANGPTL3 for research in dyslipidemia mechanisms, cardiovascular disease models, and development of ANGPTL3-targeted therapies (e.g., monoclonal antibodies or gene silencing approaches) for treating hypertriglyceridemia and atherosclerosis.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1680 nt

Amino acid sequence size: 460 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGN HETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDEC GENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months