mRNA-ANGPT2

Cat.#	Gene	Scale	State
LS-RMAbt-047	mRNA-ANGPT2	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-047 mRNA-ANGPT2 1mg Lyophilized/Liquid
Product Overview

mRNA- ANGPT2 (Angiopoietin-2, ANG2) is a ready-to-use mRNA product encoding Angiopoietin-2 (ANG2). It is suitable for research on angiogenesis, tumor vascular regulation, and anti-angiogenic therapy development. ANG2 regulates the Tie2 receptor signaling pathway and plays a key role in vascular remodeling and tumor angiogenesis. It is an important therapeutic target in the development of antibody drugs such as Faricimab.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1788 nt

Amino acid sequence size: 496 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months