circRNA-mCherry

Cat.#	Gene	Scale	State
LS-RC03	circRNA-mCherry	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RC03 circRNA-mCherry 1mg Lyophilized/Liquid
Product Overview

CircRNA-mCherry is a circular RNA (circRNA) product encoding the mCherry red fluorescent protein. It is suitable for RNA stability studies, fluorescence tracking, and cell imaging experiments. CircRNAs offer high stability, low immunogenicity, and sustained expression, making CircRNAmCherry ideal for long-term fluorescence monitoring and RNA function research.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1754 nt

Amino acid sequence size: 236 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRH STGGMDELYK
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months