circRNA-EGFP

Cat.#	Gene	Scale	State
LS-RC02	circRNA-EGFP	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RC02 circRNA-EGFP 1mg Lyophilized/Liquid
Product Overview

CircRNA-eGFP (Enhanced Green Fluorescent Protein) is a circular RNA (circRNA) product encoding enhanced green fluorescent protein (eGFP). It is suitable for RNA expression studies and cell tracking research. CircRNA-eGFP offers high stability and sustained protein expression, making it ideal for live-cell imaging and functional genomics analysis.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1763 nt

Amino acid sequence size: 239 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAG ITLGMDELYK
Cell Expression result

Cell Line: 293T

Culture Plate: 96-well plate

Cell Confluency: 80%

Transfection Dose: 200 ng per wel
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months