HQ-circRNA-mCherry

Cat.#	Gene	Scale	State
LS-RC06	HQ-circRNA-mCherry	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RC06 HQ-circRNA-mCherry 1mg Lyophilized/Liquid
Product Overview

HQ-CircRNA-mCherry (High-Quality Circular RNA–mCherry) is a high-purity circular RNA (circRNA) product encoding the mCherry red fluorescent protein. It is ideal for studies on RNA stability, translational efficiency, and fluorescent reporter assays. This product is rigorously purified to ensure high RNA purity and low immunogenicity, making it well-suited for long-term fluorescence tracking and in vivo experiments.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1754 nt

Amino acid sequence size: 236 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months