HQ-circRNA-EGFP

Cat.#	Gene	Scale	State
LS-RC05	HQ-circRNA-EGFP	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RC05 HQ-circRNA-EGFP 1mg Lyophilized/Liquid
Product Overview

HQ-CircRNA-eGFP (High-Quality Circular RNA–eGFP) is a high-purity circular RNA product encoding enhanced green fluorescent protein (eGFP). It is designed for advanced studies on RNA stability and translational efficiency. Produced under stringent purification protocols, HQ-CircRNA-eGFP offers exceptional RNA purity and minimal immunogenicity, making it ideal for in vivo applications and long-term expression studies.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1763 nt

Amino acid sequence size: 239 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAG ITLGMDELYK
Cell Expression result

Cell Line: 293T

Culture Plate: 96-well plate

Cell Confluency: 80%

Transfection Dose: 200 ng per well
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months